PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g21940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 638aa    MW: 72517.1 Da    PI: 6.8981
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g21940genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3764.4e-24115216199
                EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g  W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++el+
  Tp7g21940 115 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYHWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGENGELR 210
                88****************************9643..445569************************************************..449999** PP

                EEEE-S CS
         B3  94 vkvfrk 99 
                v+v+r+
  Tp7g21940 211 VGVRRA 216
                ****97 PP

2Auxin_resp112.63.7e-37241320183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a ha++t+++F+++Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtvvgv+d++p +W++S+Wr+L+
   Tp7g21940 241 ACHATQTRTMFTIYYKPRT--SQFIISLKKYREAMNNKFSVGMRFKMRFEGEDSPERRFSGTVVGVKDCSP-HWKDSNWRCLE 320
                 6899**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.8E-42106230IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-38108244IPR015300DNA-binding pseudobarrel domain
CDDcd100175.19E-20113215No hitNo description
PfamPF023628.7E-22115216IPR003340B3 DNA binding domain
PROSITE profilePS5086312.534115217IPR003340B3 DNA binding domain
SMARTSM010194.3E-23115217IPR003340B3 DNA binding domain
PfamPF065074.2E-33241319IPR010525Auxin response factor
PfamPF023091.2E-7501558IPR033389AUX/IAA domain
SuperFamilySSF542771.5E-12517598No hitNo description
PROSITE profilePS5174526.393522614IPR000270PB1 domain
PfamPF023092.1E-6567610IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MTNHGGEHLY DELWKLCAGP LVDIPQAEER VYYFPQGHME QLEASTQQDL NMMKPLFDLP  60
PKILCRVMNV RLQAEKDTDE VYAQITLIPE GNQVDEPMSP DPSPPESQRP KVHSFSKVLT  120
ASDTSTHGGF SVLRKHATEC LPPLDMTQQT PTQELVAEDV HGYHWKFKHI FRGQPRRHLL  180
TTGWSTFVTS KRLVAGDTFV FLRGENGELR VGVRRANRQQ SSMPSSVISS HSMHLGVLAT  240
ACHATQTRTM FTIYYKPRTS QFIISLKKYR EAMNNKFSVG MRFKMRFEGE DSPERRFSGT  300
VVGVKDCSPH WKDSNWRCLE VHWDEPASIL RRDKVSPWEI EPFVTSENVP QLVVLKNKRP  360
RHVSEASAPD VGIRAANLWS SVLTQSHELA QSCITSQRNS PQQCYRDATE DAKNSDWPIS  420
PYSVSNASKD STLNDQMVFP VEQKKPESTT SYRLFGIDLM SSSLPASEEK TTPMRPINIT  480
KPTLDSNSDP KSDISKLSEE KKQEPAQASP KEVQSKQISS TRSRTKVQMQ GIPVGRAVDL  540
TVLNGYSELI DDLEKLFDIK GELRSRNQWE IVFTDDEGDM MLVGDDPWPE FCNMVKRIFI  600
WSKEEVKKMT PGNQLPILLM EIDKTLTTTI SKTENHSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-163934319355Auxin response factor 1
4ldw_A1e-163934319355Auxin response factor 1
4ldw_B1e-163934319355Auxin response factor 1
4ldx_A1e-163934319355Auxin response factor 1
4ldx_B1e-163934319355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413488.10.0hypothetical protein EUTSA_v10024554mg
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4P5Z30.0V4P5Z3_EUTSA; Auxin response factor
STRINGBra019255.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9